PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25993s0181.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family BES1
Protein Properties Length: 686aa    MW: 76424.3 Da    PI: 6.6264
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25993s0181.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8221617.8e-50632131143
                DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr...kgskpl..eeaeaags 84 
                           g+s+r+++ +E+E++k+RER+RRai+a+i+ GLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++   +g+kp+  ++a aags
  Bostr.25993s0181.1.p  63 GASRRSRPLEEKERTKLRERHRRAITARILGGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPsksQGTKPPggSSAIAAGS 151
                           689******************************************************************98889999999766666676 PP

                DUF822  85 sas..aspesslq.sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvl 143
                           sas  as+++s   ++++ss ++spve +s+ +k + +p+ps +d  +++s++ + +v + +
  Bostr.25993s0181.1.p 152 SAShvASQQTSPPaLRVVSSGQRSPVELSSCHMKGVFTPAPSPYDIPPTQSPELVGSVNKAE 213
                           66656788888877*********************************999985555444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.2E-4165196IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514458.59E-172240683IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.802.0E-185243681IPR013781Glycoside hydrolase, catalytic domain
PfamPF013731.6E-94249668IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.5E-64280294IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.5E-64301319IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.5E-64323344IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060327335IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR007501.5E-64416438IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.5E-64489508IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.5E-64523539IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.5E-64540551IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.5E-64558581IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.5E-64598620IPR001554Glycoside hydrolase, family 14
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MATDMQKLLG TSEEDDDEEM DMDVKEEDDD QRNRGTRAAS GSSNDEFMFQ QSMQDQLGTP  60
GGGASRRSRP LEEKERTKLR ERHRRAITAR ILGGLRRHGN YNLRVRADIN DVIAALAREA  120
GWVVLPDGTT FPSKSQGTKP PGGSSAIAAG SSASHVASQQ TSPPALRVVS SGQRSPVELS  180
SCHMKGVFTP APSPYDIPPT QSPELVGSVN KAEGLVGCSV DVIKSKQILE IPPNLTEQDF  240
SGTPYVPVYV MLPLGVINMK CELADRDGLL KHLRILKSIH VDGVKVDCWW GIVEGHSPLE  300
YNWNGYRQLF QMVRDLNLKI QVLMSFHECG GNVGDDVCIP LPHWVAEIGR TNPDIYFTDR  360
EGRRNPECLS WGVDKERVLR GRTALEVYFD YMRSFRIGLA EFLEDGVISM VEIGLGPCGE  420
LRYPSCPIKH GWRYPGVGEF QCYDKYLLKS LRKAAESRGH LFWARGPDNT GSYNSQPQRT  480
GFFCDGGDYD GLYGRFFLKW YSQVLINHAD QILSLAKLVF DSSCIAAKLP DVHWWYRTTS  540
HAAELTAGFY NPSNRDGYAA IASTLKKHGA TLSFVSGEVQ VLNRPDDFSG ALGEPEAVAW  600
QVLNAAWDSD TPIARENSLP CHDRVGYNKM LESVKFPKDP DRRHLSSFGY SRLVPALMEG  660
HNIVEFERFV KKLHGEAVMN HHQQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wdq_A1e-14024567611444Beta-amylase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2273230.0AK227323.1 Arabidopsis thaliana mRNA for putative beta-amylase, complete cds, clone: RAFL14-01-P19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293786.10.0hypothetical protein CARUB_v10022771mg
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLR0HB940.0R0HB94_9BRAS; Beta-amylase
STRINGAT2G45880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29452535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7